PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31650.1
Common NameF28M20.160, REM6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 493aa    MW: 56230.6 Da    PI: 10.4232
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.55.8e-192095990
                 HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
           B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
                   +ks+ + +p kf++++ +  k+e+kt++l++ +s r+W+vk+      ++++lt+GWkeFv+a++L+  Dfv+Fk++g++ f
  AT4G31650.1 20 PGFKSH-INIPVKFFSKYiK-GKHEGKTVKLRSdSSKRTWKVKI------EGHTLTDGWKEFVEAHDLRISDFVIFKHKGDMFF 95
                 567777.99*********64.456889*****96777*******......6678***********************9998777 PP

2B360.33.2e-19132226299
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  f++ ++ ++l ++ + +p++fa+++g +  +  +++l++e+g+ We ++i + ksg+++ ++GWk+ + + +L++gD+++Fkl + + + +v+++++k
  AT4G31650.1 132 FSQSVTTSNLMRDSVGVPRDFAKRYGFNIGR-HEIVLMNEEGKPWESEVI-SYKSGKVIVAGGWKSLCTESKLEVGDSCTFKLLH-NAKMPVFRLCSK 226
                  56677788888889***********877655.59***************5.77778899999********************998.566689999875 PP

3B365.67.4e-212963731694
                  EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
           B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                   +lp++f+++ g++k +s +++l++e  r+W++ l++r ++++++ ++GW++F+++ngLk gD+v+Fkl++++++++++
  AT4G31650.1 296 KSLPRNFVRSDGLIK-GSNKIVLMNEGARTWTLILKFRDSRRSFYSRGGWRSFCRENGLKPGDSVTFKLESSNTKTPLL 373
                  489********9997.567**************************************************9876665654 PP

4B363.82.6e-20391490199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvf 97 
                  f++ ++++++ +s+rl+l+kkf++ ++++ +++k++tl d++g++W v+l ++k+  r+vl++G +eF++a g+k+ ++vv++l+++ +++ +++k++
  AT4G31650.1 391 FLTLTVTPSSIRSSRLYLSKKFISVNKMERAGGKKITLLDKNGEEWPVTLLMDKRYTRMVLGSGLREFCNAIGVKAYESVVLELVWEeTTTLPMFKFC 488
                  77888999******************9999*******************************************************9988888999999 PP

                  -S CS
           B3  98 rk 99 
                  +k
  AT4G31650.1 489 SK 490
                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.8E-237103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-209107IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.63311103IPR003340B3 DNA binding domain
CDDcd100174.39E-151298No hitNo description
SMARTSM010192.7E-2214103IPR003340B3 DNA binding domain
PfamPF023621.6E-132392IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-19124225IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-19125225IPR015300DNA-binding pseudobarrel domain
CDDcd100173.74E-14131225No hitNo description
PROSITE profilePS5086313.521131226IPR003340B3 DNA binding domain
SMARTSM010191.6E-23132227IPR003340B3 DNA binding domain
PfamPF023621.7E-18132226IPR003340B3 DNA binding domain
PROSITE profilePS5086315.115281378IPR003340B3 DNA binding domain
SMARTSM010192.1E-20285379IPR003340B3 DNA binding domain
PfamPF023622.9E-18296372IPR003340B3 DNA binding domain
CDDcd100171.35E-19297376No hitNo description
Gene3DG3DSA:2.40.330.101.9E-15297370IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-17297375IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-16384486IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-17387488IPR015300DNA-binding pseudobarrel domain
CDDcd100174.93E-16390488No hitNo description
SMARTSM010192.0E-27391491IPR003340B3 DNA binding domain
PfamPF023622.0E-19391490IPR003340B3 DNA binding domain
PROSITE profilePS5086311.505391490IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MNNPTLFSPK SPHFFQPLLP GFKSHINIPV KFFSKYIKGK HEGKTVKLRS DSSKRTWKVK  60
IEGHTLTDGW KEFVEAHDLR ISDFVIFKHK GDMFFDVTAL GSSCWESSRK EKEIEENIET  120
EPDQFSSDLT CFSQSVTTSN LMRDSVGVPR DFAKRYGFNI GRHEIVLMNE EGKPWESEVI  180
SYKSGKVIVA GGWKSLCTES KLEVGDSCTF KLLHNAKMPV FRLCSKLPKA GAEARPLKRA  240
RVQRWSQESR SKHDVREKIA EEGEPSRRNR TSNKSTGDQG KLQQTQSCFI FDHVAKSLPR  300
NFVRSDGLIK GSNKIVLMNE GARTWTLILK FRDSRRSFYS RGGWRSFCRE NGLKPGDSVT  360
FKLESSNTKT PLLLFSIAES KSASTKDRTR FLTLTVTPSS IRSSRLYLSK KFISVNKMER  420
AGGKKITLLD KNGEEWPVTL LMDKRYTRMV LGSGLREFCN AIGVKAYESV VLELVWEETT  480
TLPMFKFCSK IKT
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184178470.0
Expression AtlasAT4G31650-
AtGenExpressAT4G31650-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0310040.0AL031004.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F28M20 (ESSAII project).
GenBankAL1615790.0AL161579.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 75.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194893.10.0B3 domain-containing protein REM6
SwissprotO817820.0REM6_ARATH; B3 domain-containing protein REM6
TrEMBLV4P3N91e-140V4P3N9_EUTSA; Uncharacterized protein
STRINGAT4G31650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]